Sequence 1: | NP_001303488.1 | Gene: | CG17803 / 42141 | FlyBaseID: | FBgn0038547 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359947.1 | Gene: | ztf-3 / 171617 | WormBaseID: | WBGene00016905 | Length: | 336 | Species: | Caenorhabditis elegans |
Alignment Length: | 270 | Identity: | 59/270 - (21%) |
---|---|---|---|
Similarity: | 114/270 - (42%) | Gaps: | 66/270 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 QGVKELPHHICS----TC--QETVNKSMEFRAKCQQVDKKLRQTTE--KYNIQICDEEMESELEN 180
Fly 181 VLYEE-SAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFAL 244
Fly 245 EQNKSCNEIISIRKCKTKEEIGKVDH---GAKVYKVVLGEYNSLKETAPKYS----LSLPKKPQL 302
Fly 303 --------RVSPEEKNRRRRERI------QAKPLN--YVCDKCGHTFRQRSQLQMHLLRHNRAKN 351
Fly 352 FECPECPKKF 361 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17803 | NP_001303488.1 | zf-AD | 86..160 | CDD:214871 | 5/41 (12%) |
COG5048 | <323..528 | CDD:227381 | 18/41 (44%) | ||
zf-C2H2 | 324..346 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 326..346 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 354..375 | CDD:275368 | 3/8 (38%) | ||
C2H2 Zn finger | 383..401 | CDD:275368 | |||
C2H2 Zn finger | 426..446 | CDD:275368 | |||
C2H2 Zn finger | 454..474 | CDD:275368 | |||
C2H2 Zn finger | 481..501 | CDD:275368 | |||
C2H2 Zn finger | 509..528 | CDD:275368 | |||
ztf-3 | NP_001359947.1 | zf-C2H2 | 231..253 | CDD:333835 | 11/21 (52%) |
C2H2 Zn finger | 233..253 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 261..279 | CDD:275368 | 3/8 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |