DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and ztf-3

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001359947.1 Gene:ztf-3 / 171617 WormBaseID:WBGene00016905 Length:336 Species:Caenorhabditis elegans


Alignment Length:270 Identity:59/270 - (21%)
Similarity:114/270 - (42%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QGVKELPHHICS----TC--QETVNKSMEFRAKCQQVDKKLRQTTE--KYNIQICDEEMESELEN 180
            :.:.::|.::.:    ||  ::.:.:..:...|.::|.:..:..::  |..:..|:..::.::.|
 Worm    33 KNIIKIPDNLSNVNQLTCLVKQFLREQQDLAVKVEKVQENQKNLSDFVKEKLTNCNCHVQLDVRN 97

  Fly   181 VLYEE-SAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFAL 244
            :|.:| ..|..:...|| |||.:|...|.              |.|::|.::: :|.|.::.|.|
 Worm    98 LLAKEMKLQDLRQDDGL-DFSIKLPSTSS--------------TDFTVSLNQV-VDADAQQRFDL 146

  Fly   245 EQNKSCNEIISIRKCKTKEEIGKVDH---GAKVYKVVLGEYNSLKETAPKYS----LSLPKKPQL 302
            |..|...             .|.:.|   ...:|     :::.:..|:.:.:    ..|...|:|
 Worm   147 ELLKMFG-------------AGNIPHFQPPPDLY-----QHHHIPHTSQQVAQENLAMLANVPKL 193

  Fly   303 --------RVSPEEKNRRRRERI------QAKPLN--YVCDKCGHTFRQRSQLQMHLLRHNRAKN 351
                    ..|||:..:|.::|.      :|:|.|  |.|..|..||||:..|..|||.|.....
 Worm   194 DDNNAYFDTFSPEKSGKRAKKRAAPSSAHEAQPNNGPYKCRDCEKTFRQKHGLNQHLLTHETNGA 258

  Fly   352 FECPECPKKF 361
            |||..|.|::
 Worm   259 FECDGCGKRY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 5/41 (12%)
COG5048 <323..528 CDD:227381 18/41 (44%)
zf-C2H2 324..346 CDD:278523 11/21 (52%)
C2H2 Zn finger 326..346 CDD:275368 10/19 (53%)
C2H2 Zn finger 354..375 CDD:275368 3/8 (38%)
C2H2 Zn finger 383..401 CDD:275368
C2H2 Zn finger 426..446 CDD:275368
C2H2 Zn finger 454..474 CDD:275368
C2H2 Zn finger 481..501 CDD:275368
C2H2 Zn finger 509..528 CDD:275368
ztf-3NP_001359947.1 zf-C2H2 231..253 CDD:333835 11/21 (52%)
C2H2 Zn finger 233..253 CDD:275368 10/19 (53%)
C2H2 Zn finger 261..279 CDD:275368 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.