DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and LOC100535385

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_003200145.1 Gene:LOC100535385 / 100535385 -ID:- Length:361 Species:Danio rerio


Alignment Length:380 Identity:98/380 - (25%)
Similarity:144/380 - (37%) Gaps:124/380 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 SEGVLDEDDFPLDAEPTQFSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTKEEIGKVDHG 271
            :|.|.:|.|:..|.||::.. .||..|.|.||:.....|:::                       
Zfish     7 TECVEEEIDYTSDPEPSRIK-DEDTEDTDEDTDSTDIKEESE----------------------- 47

  Fly   272 AKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQAKPLNYVCDKCGHTFRQR 336
                     |....:|..|.      :||   .:|||....|.:..:||. :::|.:||.:|.:|
Zfish    48 ---------EQEEAEEKDPH------QKP---FTPEEMAPERSKNTKAKG-SFMCPQCGKSFTRR 93

  Fly   337 SQLQMHLLRHNRAKNFECPECPKKFYDLYTRN----IHVRALHKGEHPFPCNHCNESFANASSRH 397
            ..|:.|...|...|.:.|..|.|.|    |||    .|:| :|.||.||.|..|.:||....|..
Zfish    94 DSLKEHSRIHTGEKPYTCHYCGKCF----TRNESLKHHIR-IHTGEKPFECQQCGKSFTFKKSLK 153

  Fly   398 RHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKKG------------------------ 438
            .||            |:.|:|:   ...||||.|..|.|||                        
Zfish   154 VHE------------RIHSREK---LFICTQCGKGLTCKKGLEDHLRAHTGVKPFKCLHCGKMFK 203

  Fly   439 ----LVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALH-DKFPIRCDI--------------- 483
                |..|::.|:|.:||:|..|...:..||.::.|..:| |:.|..|.|               
Zfish   204 WAHSLTYHLHTHSGDKPFKCVHCGEGYISPSILRNHMKVHTDEKPYACTICGKKFLWLGNFKDHQ 268

  Fly   484 -------------CLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKH 525
                         |.|||....:|.:||.:|:|..|::|..||..:....:|..|
Zfish   269 KRHTGERDQQCAECGKGFTTSKRLKEHQKIHSGEKPYKCSQCDKCFTQSGSLKCH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 73/264 (28%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..375 CDD:275368 9/24 (38%)
C2H2 Zn finger 383..401 CDD:275368 6/17 (35%)
C2H2 Zn finger 426..446 CDD:275368 11/47 (23%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 9/47 (19%)
C2H2 Zn finger 509..528 CDD:275368 5/17 (29%)
LOC100535385XP_003200145.1 COG5048 69..>355 CDD:227381 76/276 (28%)
C2H2 Zn finger 83..103 CDD:275368 7/19 (37%)
zf-H2C2_2 95..120 CDD:290200 8/28 (29%)
C2H2 Zn finger 111..131 CDD:275368 9/24 (38%)
zf-H2C2_2 123..147 CDD:290200 10/24 (42%)
C2H2 Zn finger 139..159 CDD:275368 8/31 (26%)
C2H2 Zn finger 167..187 CDD:275368 9/19 (47%)
C2H2 Zn finger 195..215 CDD:275368 2/19 (11%)
C2H2 Zn finger 223..243 CDD:275368 5/19 (26%)
zf-H2C2_2 236..258 CDD:290200 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 2/19 (11%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 9/23 (39%)
C2H2 Zn finger 307..327 CDD:275368 5/17 (29%)
zf-H2C2_2 319..344 CDD:290200 2/5 (40%)
C2H2 Zn finger 335..353 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.