DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and si:cabz01032454.3

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_003198589.1 Gene:si:cabz01032454.3 / 100534979 ZFINID:ZDB-GENE-161017-73 Length:499 Species:Danio rerio


Alignment Length:385 Identity:101/385 - (26%)
Similarity:147/385 - (38%) Gaps:108/385 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DSEGVLDEDDFPL---DAEPTQFSLSEDEL-------DLDR-DTEKDFALEQNKSCNEIISIRKC 259
            :||.:..||.|.:   |.|.|:..:.::|.       :.|: :|.:|...::..||.     |..
Zfish     7 ESEDLKIEDTFTVKQEDPEQTELMVLKEETQEMNEMKEKDQIETHQDLTTDEQSSCK-----RSP 66

  Fly   260 KTKEEI-----GK-VDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEKNRRRRERIQ 318
            |||.:.     || .:|                            :|.|.|         ..||.
Zfish    67 KTKSDFICSQCGKGFNH----------------------------QPNLIV---------HMRIH 94

  Fly   319 AKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRNIHVRALHKGEHPFPC 383
            .....|.||:||.:|.|..:|::|:..|.:.:.:.||:|.|.|....:.|:|:| :|.||.||||
Zfish    95 TGERPYSCDQCGKSFSQNEKLKVHMRVHTKERPYTCPQCGKSFTQKESLNVHIR-VHTGEKPFPC 158

  Fly   384 NHCNESFANASSRHRH------ER------------------------------DVHGAGNR--- 409
            .||.:.|:...:...|      ||                              |....|.|   
Zfish   159 QHCGKRFSQLHALKEHVTIHTGERPHACTVCGKTFYHKQKLEKHMTVHTGEKLFDCQQCGKRFGQ 223

  Fly   410 -------IRTRVKSKEEGSSRHY-CTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFADPSA 466
                   ::...|.|.....:.| ||:|.|::.||..|..||..|.|.:||.|..|...|...|.
Zfish   224 KDSLRIHMKLHTKDKPHAKEKPYICTECDKAFASKSNLNHHMVTHTGEKPFSCDECGKSFGQNSK 288

  Fly   467 MKRHQALHDK-FPIRCDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKH 525
            :|.|..:|.| .|..||.|.|.|....:|..|..|||...|:.|..|...:..:.||..|
Zfish   289 LKVHMRVHTKEKPYSCDQCGKSFSQNEKLKVHMRVHTKERPYTCPQCGKSFTQKENLKVH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 75/251 (30%)
zf-C2H2 324..346 CDD:278523 9/21 (43%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
C2H2 Zn finger 354..375 CDD:275368 8/20 (40%)
C2H2 Zn finger 383..401 CDD:275368 5/23 (22%)
C2H2 Zn finger 426..446 CDD:275368 9/19 (47%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 5/17 (29%)
si:cabz01032454.3XP_003198589.1 COG5048 52..481 CDD:227381 90/340 (26%)
C2H2 Zn finger 74..94 CDD:275368 7/56 (13%)
zf-H2C2_2 86..111 CDD:290200 10/33 (30%)
C2H2 Zn finger 102..122 CDD:275368 8/19 (42%)
zf-H2C2_2 115..139 CDD:290200 8/23 (35%)
C2H2 Zn finger 130..150 CDD:275368 8/20 (40%)
zf-H2C2_2 142..167 CDD:290200 13/25 (52%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 186..206 CDD:275368 0/19 (0%)
C2H2 Zn finger 214..234 CDD:275368 2/19 (11%)
C2H2 Zn finger 248..268 CDD:275368 9/19 (47%)
zf-H2C2_2 260..283 CDD:290200 9/22 (41%)
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 289..313 CDD:290200 10/23 (43%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
zf-H2C2_2 317..341 CDD:290200 8/23 (35%)
C2H2 Zn finger 332..352 CDD:275368 5/17 (29%)
zf-H2C2_2 344..367 CDD:290200 3/5 (60%)
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 388..408 CDD:275368
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 444..464 CDD:275368
C2H2 Zn finger 472..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.