DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and zgc:174653

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001108366.1 Gene:zgc:174653 / 100141328 ZFINID:ZDB-GENE-080218-2 Length:392 Species:Danio rerio


Alignment Length:352 Identity:92/352 - (26%)
Similarity:138/352 - (39%) Gaps:93/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VLYEESAQQAKGVVGLEDFSSELLPDSEGVLDEDDFPLDAEPT-QFSLSEDELDLDRDTEKDFAL 244
            :|.||:.||                 :|......|.|.|.:|| ....|.....|:..:|.:|:.
Zfish     9 MLKEETHQQ-----------------NEVEEKHQDIPTDEKPTLTKKTSSHRRHLNYKSECNFSC 56

  Fly   245 EQNKSCNEIISIRKCKTKEEIGKVDHGAKVYKVVLGEYNSLKETAPKYSLSLPKKPQLRVSPEEK 309
            :|::.                                             |..:||.|.|.....
Zfish    57 KQSRK---------------------------------------------SFSQKPNLGVHMRVH 76

  Fly   310 NRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYTRN--IHVR 372
            ||.:         :|.|.:||.:|.:...|:.|:..|...:::.|.:|.|.|:  |.||  :|:|
Zfish    77 NREK---------HYTCKQCGKSFPKIHFLKAHMRIHIGERSYTCQQCGKIFH--YARNLAVHMR 130

  Fly   373 ALHKGEHPFPCNHCNESFANASSRHRHERDVHGAGNRIRTRVKSKEEGSSRHYCTQCTKSYTSKK 437
             :|.||.|:.|..|.:||     :..:..:||     :||..     |.....||||.||:..|:
Zfish   131 -IHTGEKPYSCPQCGKSF-----KQNNNLEVH-----MRTHT-----GERSFTCTQCGKSFAKKQ 179

  Fly   438 GLVLHMNFHNGSRPFQCKICQMKFADPSAMKRHQALH-DKFPIRCDICLKGFLLRSQLTKHQDVH 501
            .|.:||..|.|.:||.|..|...|.:.|.:..|:..| .:.|.||..|.|.|..:|....|..:|
Zfish   180 NLKIHMRIHTGEKPFTCTECGKSFRNKSTLNIHKRTHTGEKPYRCTECGKSFPNKSTFNNHMRIH 244

  Fly   502 TGMHPHRCEICDVHYRHRYNLNKHKNT 528
            ||..|:||..|...:..:..||.|..|
Zfish   245 TGEKPYRCTECGKSFIRKSTLNYHVRT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871
COG5048 <323..528 CDD:227381 68/207 (33%)
zf-C2H2 324..346 CDD:278523 7/21 (33%)
C2H2 Zn finger 326..346 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..375 CDD:275368 9/22 (41%)
C2H2 Zn finger 383..401 CDD:275368 4/17 (24%)
C2H2 Zn finger 426..446 CDD:275368 10/19 (53%)
C2H2 Zn finger 454..474 CDD:275368 5/19 (26%)
C2H2 Zn finger 481..501 CDD:275368 6/19 (32%)
C2H2 Zn finger 509..528 CDD:275368 5/18 (28%)
zgc:174653NP_001108366.1 C2H2 Zn finger 56..76 CDD:275368 6/64 (9%)
C2H2 Zn finger 84..104 CDD:275368 6/19 (32%)
C2H2 Zn finger 112..132 CDD:275368 9/22 (41%)
COG5048 <117..363 CDD:227381 59/173 (34%)
zf-H2C2_2 124..149 CDD:290200 11/30 (37%)
C2H2 Zn finger 140..160 CDD:275368 7/29 (24%)
zf-H2C2_2 152..176 CDD:290200 11/33 (33%)
C2H2 Zn finger 168..188 CDD:275368 10/19 (53%)
zf-H2C2_2 180..205 CDD:290200 10/24 (42%)
C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
zf-H2C2_2 209..231 CDD:290200 7/21 (33%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
zf-H2C2_2 237..261 CDD:290200 8/23 (35%)
C2H2 Zn finger 252..272 CDD:275368 6/20 (30%)
C2H2 Zn finger 280..300 CDD:275368
C2H2 Zn finger 308..328 CDD:275368
C2H2 Zn finger 335..355 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.