DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17803 and znf1154

DIOPT Version :9

Sequence 1:NP_001303488.1 Gene:CG17803 / 42141 FlyBaseID:FBgn0038547 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001373763.1 Gene:znf1154 / 100006786 ZFINID:ZDB-GENE-080218-28 Length:436 Species:Danio rerio


Alignment Length:469 Identity:108/469 - (23%)
Similarity:176/469 - (37%) Gaps:109/469 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CQETVNKSMEFRAKCQQVDKKLRQTTEKYNIQICDEEMESELENVLYEESAQQAKGVVGLEDFSS 201
            |...:|.... ..:|.::.......|..::::      .|||.:....|..:|.           
Zfish     6 CDPPLNHKKN-SVRCFRLAVMTSALTRSFSVE------SSELSSAAISERQRQG----------- 52

  Fly   202 ELLPDSEGVLDEDDFPLDAEPTQ----FSLSEDELDLDRDTEKDFALEQNKSCNEIISIRKCKTK 262
             ||.|||.:.|.:...:..|.|:    ..:.|:..||..|.||                .:.|::
Zfish    53 -LLKDSEKMSDPEPCRIKQEETEELIDVMVKEEREDLSEDEEK----------------HQVKSE 100

  Fly   263 EEIG-KVDHGAKVYKVVLGEYNSL---KETAPKYSLSLPKKPQLRVSPEE--------------- 308
            ||.. |:||...:....:.::...   |..:.||:|::    .:|:...|               
Zfish   101 EETRIKIDHNFLMETTAVKDFTCTQCGKSFSQKYNLNV----HMRIHTGEQPYKCSHCDMRFHCA 161

  Fly   309 KNRRRRERIQAKPLNYVCDKCGHTFRQRSQLQMHLLRHNRAKNFECPECPKKFYDLYT----RNI 369
            :|.:..|.:......:.||.|..||.:.:.|:|||..|.:.|.:.|..|.|.|....:    ..|
Zfish   162 RNLKSHEMLHTGEKPHKCDHCSKTFIRATDLKMHLRVHTKEKPYSCSVCGKSFTQTSSLRKHEKI 226

  Fly   370 HV-----------------------RALHKGEHPFPCNHCNESFANASSRHRHERDVHG------ 405
            |.                       :.:|.||.|:.|:||:..|........|:.::..      
Zfish   227 HTGVREFVCFECGKSFIKAGDLKRHQMIHTGEKPYKCSHCDLRFRYLGHLKAHQMNLTSEEQLAC 291

  Fly   406 --AGNRIRTRVKSKEE-----GSSRHYCTQCTKSYTSKKGLVLHMNFHNGSRPFQCKICQMKFAD 463
              .|...|...|....     |...|.|.||.|::....||..|:..|...||:.|.:|..:|..
Zfish   292 TQCGKSFRQLTKLNRHMLIHTGERPHKCDQCCKTFLKASGLKKHLRVHTNERPYSCSVCGNRFTQ 356

  Fly   464 PSAMKRHQALHDKFPIR---CDICLKGFLLRSQLTKHQDVHTGMHPHRCEICDVHYRHRYNLNKH 525
            .|::::||.:|.  .:|   |..|.|.|:....|.:||.:|||..|::|..||..:|....|..|
Zfish   357 ASSLRKHQHIHT--GVREFVCSECEKSFITAGDLRRHQMIHTGEKPYKCSHCDKRFRRSERLKAH 419

  Fly   526 KNTDLHRDNMQKAI 539
            :.|  ||:....||
Zfish   420 EIT--HREKHTNAI 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17803NP_001303488.1 zf-AD 86..160 CDD:214871 3/22 (14%)
COG5048 <323..528 CDD:227381 66/247 (27%)
zf-C2H2 324..346 CDD:278523 9/21 (43%)
C2H2 Zn finger 326..346 CDD:275368 9/19 (47%)
C2H2 Zn finger 354..375 CDD:275368 6/47 (13%)
C2H2 Zn finger 383..401 CDD:275368 5/17 (29%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
C2H2 Zn finger 454..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
C2H2 Zn finger 509..528 CDD:275368 6/18 (33%)
znf1154NP_001373763.1 COG5048 <95..393 CDD:227381 69/303 (23%)
C2H2 Zn finger 123..143 CDD:275368 5/23 (22%)
C2H2 Zn finger 151..171 CDD:275368 2/19 (11%)
C2H2 Zn finger 179..199 CDD:275368 9/19 (47%)
C2H2 Zn finger 207..227 CDD:275368 4/19 (21%)
C2H2 Zn finger 235..255 CDD:275368 0/19 (0%)
C2H2 Zn finger 263..281 CDD:275368 5/17 (29%)
C2H2 Zn finger 291..311 CDD:275368 3/19 (16%)
C2H2 Zn finger 319..339 CDD:275368 7/19 (37%)
C2H2 Zn finger 347..367 CDD:275368 6/19 (32%)
C2H2 Zn finger 375..395 CDD:275368 7/19 (37%)
zf-H2C2_2 387..412 CDD:404364 10/24 (42%)
C2H2 Zn finger 403..423 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.