DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ING2

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_974025.1 Gene:ING2 / 841881 AraportID:AT1G54390 Length:328 Species:Arabidopsis thaliana


Alignment Length:405 Identity:77/405 - (19%)
Similarity:122/405 - (30%) Gaps:178/405 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SATYVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHY--YDLYLSLQNSADAG------ 70
            :..|||:|::.....|.::||.|:.:|::|.:.:.||......  |.|.|:.|:|....      
plant     6 TGVYVDDYLEYASTFPAELQRLLNTVRELDERSQSLINQTRQQTKYCLGLASQSSKKGNGNHYNN 70

  Fly    71 ---RRSRSISRMHQSLIQAQE----LGDEKMQIVNHMQEIIDGKLRQLDTDQQNL--DLKEDRDR 126
               ....:|.:|.:.:..:||    |..||:.:.....::||..:::||.|..|.  |||::   
plant    71 GGLDEEETIEKMRKEIESSQENALSLCTEKVLLARQAYDLIDSHVKRLDEDLNNFAEDLKQE--- 132

  Fly   127 YALLDDGTPSKLQRLQSPMREQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGN 191
             ..:....||.|..|.                                     :||.:....|..
plant   133 -GKIPPDEPSVLPPLP-------------------------------------IVPKAEKRKSFY 159

  Fly   192 GGGSTPNSERSSHVSNGGNSGSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNS 256
            |   ||..::..:                             |.|:..                 
plant   160 G---TPQPKKIDY-----------------------------RDRDWD----------------- 175

  Fly   257 ANEASGSGGGSGERKSSLGGASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGN 321
                                     :.|...|....||                           
plant   176 -------------------------RDRDFELMPPPGS--------------------------- 188

  Fly   322 NSGKKKKRKVRGSGASNANASTREETPPPETIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHF 386
                  .||         :....||.|    |||:|||||||:|:|||:||.|||:...:...|.
plant   189 ------NRK---------DLMPIEEQP----IDPNEPTYCVCHQVSFGDMIACDNENVSLLSQHL 234

  Fly   387 SCVSLVLKPKGKWFC 401
            ....|:.....:.||
plant   235 IIYFLMYSCYDETFC 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 29/113 (26%)
PHD_ING1_2 360..404 CDD:277059 17/42 (40%)
ING2NP_974025.1 ING 9..122 CDD:289749 28/112 (25%)
PHD_SF 208..>226 CDD:304600 13/17 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I1866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.