DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ING1

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_566742.1 Gene:ING1 / 821986 AraportID:AT3G24010 Length:234 Species:Arabidopsis thaliana


Alignment Length:113 Identity:55/113 - (48%)
Similarity:70/113 - (61%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 SAAT----SSGAAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANASTREETPPPE---TIDPD 356
            :|||    ::|.||..|..|.|       |:||.|  ..:.||.|.|||...:...:   .:||:
plant   121 AAATLELENNGKAGNAGEGGRG-------GRKKTR--LATAASTAAASTGMTSSNMDLDLPVDPN 176

  Fly   357 EPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPNC 404
            |||||:|||:|||||:.|||:.|.||||||.||.|..:|||||:||.|
plant   177 EPTYCICNQVSFGEMVACDNNACKIEWFHFGCVGLKEQPKGKWYCPEC 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749
PHD_ING1_2 360..404 CDD:277059 30/43 (70%)
ING1NP_566742.1 ING_plant 11..107 CDD:341097
PHD_Yng1p_like 180..225 CDD:277062 31/45 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.