DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ING4

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001121054.1 Gene:ING4 / 51147 HGNCID:19423 Length:249 Species:Homo sapiens


Alignment Length:396 Identity:91/396 - (22%)
Similarity:144/396 - (36%) Gaps:159/396 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHYYDLYLSLQNSADAGRRSRSISRMHQ 81
            |:::|:||:||||.::||....:||:|.:...|..::|.....|:|...|..:..:...:.::.:
Human     6 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE 70

  Fly    82 SLIQAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRDRYALLDDGTPSKLQRLQSPMR 146
            :..:.:|.||:|:|:.....|::|..:|:||||                       |.|.::.::
Human    71 AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTD-----------------------LARFEADLK 112

  Fly   147 EQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGNGGGSTPNSERSSHVSNGGNS 211
            |:..::                                                     |:..:|
Human   113 EKQIES-----------------------------------------------------SDYDSS 124

  Fly   212 GSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNSANEASGSGGGSGERKSSLGG 276
            .|.|...|       ||..::...|..|            ...||..||.               
Human   125 SSKGKKKG-------RTQKEKKAARARS------------KGKNSDEEAP--------------- 155

  Fly   277 ASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANA 341
                                                         .:.:||.:.||.|......:
Human   156 ---------------------------------------------KTAQKKLKLVRTSPEYGMPS 175

  Fly   342 STREETPPPET----IDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCP 402
            .|.....|.:.    :||:|||||:|:|:|:||||.|||..|.||||||:||.|..||:||||||
Human   176 VTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP 240

  Fly   403 NCRGER 408
            .|..||
Human   241 RCSQER 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 30/98 (31%)
PHD_ING1_2 360..404 CDD:277059 30/43 (70%)
ING4NP_001121054.1 TNG2 7..245 CDD:227367 88/392 (22%)
ING_ING4 11..104 CDD:341095 28/115 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..164 15/180 (8%)
Bipartite nuclear localization signal 127..148 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.