DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and bip2

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_651923.2 Gene:bip2 / 43793 FlyBaseID:FBgn0026262 Length:1406 Species:Drosophila melanogaster


Alignment Length:366 Identity:80/366 - (21%)
Similarity:128/366 - (34%) Gaps:83/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 DGKLRQLDTDQQNLDLKEDRDRYALL---DDGTPSKLQRLQSPMREQGNQAGTGNGGLNGNGLLS 166
            |.|::..| .:|..:.|:|:|:..|:   ||             .|:.::....|   |...:|.
  Fly  1083 DRKIKAND-KRQKKEKKKDKDKQILVHIPDD-------------TEEFDKVPLAN---NDEPVLK 1130

  Fly   167 AKDLY---ALGGYAGGVVPGS-NAMTSGNGGGSTPNSERSSHVSNGGN-------SGSNGNASGG 220
            :..:.   :||....|:.|.. ..:|....|.||..|.....:::.|.       |..|......
  Fly  1131 SSSMTINPSLGAATSGISPNQIPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRERD 1195

  Fly   221 GGGELQR-----TGSKRSRRRNESVVNNGSS---------------LEMGGNESNSANEASGSGG 265
            ...||.|     ||..::::.....:.|.|:               |.:....||||...| :..
  Fly  1196 NSPELARFSPLVTGPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLPVSQTSSNSAGWLS-NPN 1259

  Fly   266 GSGERKSSLGGASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRK 330
            .|....|:|..:|..   ....|..|..::.:........:.|....||......|.|       
  Fly  1260 NSNTASSTLSASSVL---LPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTS------- 1314

  Fly   331 VRGSGASNANA-STREETPPPETIDPDEPTYCV---CNQISFGE-MILCDNDLCPIEWFHFSCVS 390
                 ..|||| ...|.:.|...:|.:.....:   |.::..|. ||.||.  |. .|:|:.||.
  Fly  1315 -----EENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAMIGCDG--CD-AWYHWICVG 1371

  Fly   391 LVLKPKGK--WFCPNCRGERPNVMKPKAQFLKELERYNKEK 429
            :...||..  |||..|      |.|.:....::.:|.||:|
  Fly  1372 ITFAPKDNDDWFCRVC------VTKKRIHGSEKKKRRNKKK 1406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 3/10 (30%)
PHD_ING1_2 360..404 CDD:277059 16/49 (33%)
bip2NP_651923.2 BTP 4..80 CDD:128846
PHD_TAF3 1342..1387 CDD:276997 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.