DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ING1

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_005528.4 Gene:ING1 / 3621 HGNCID:6062 Length:422 Species:Homo sapiens


Alignment Length:384 Identity:109/384 - (28%)
Similarity:156/384 - (40%) Gaps:152/384 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YRGLIRDVDHYYDLYLSLQNSADAGRRSRSISRMHQSLIQAQELGDEKMQIVNHMQEIIDGKLRQ 110
            ::.:::::|..|:.:   ....|..::.|.:..:.::||::|||||||:|||:.|.|:::.:.||
Human   187 WKQILKELDECYERF---SRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQ 248

  Fly   111 LDTDQQNLDLKEDRDRYALLDDGTPSKLQRLQSPMREQGNQAGTGNGGLNGNGLLSAKDLYALGG 175
            :|:   :::|.|                     ..:|.|:.||                      
Human   249 VDS---HVELFE---------------------AQQELGDTAG---------------------- 267

  Fly   176 YAGGVVPGSNAMTSGNGGGSTPNSERSSHVSNGGNSGSNGNASGGGGGELQRTGSKRSRRRNESV 240
                        .||..|...|..|.::                    :..:..||||||:.   
Human   268 ------------NSGKAGADRPKGEAAA--------------------QADKPNSKRSRRQR--- 297

  Fly   241 VNNGSSLEMGGNESNSANEASGSGGGSGERKSSLGGASGAGQGRKASLQSASGSLASGSAATSSG 305
                       |..|..|.:|......        ||||..:.:||                   
Human   298 -----------NNENRENASSNHDHDD--------GASGTPKEKKA------------------- 324

  Fly   306 AAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANASTREETPPPETIDPDEPTYCVCNQISFGE 370
                            .:.|||||       |.|.|. ||.:|....|||:|||||:|||:|:||
Human   325 ----------------KTSKKKKR-------SKAKAE-REASPADLPIDPNEPTYCLCNQVSYGE 365

  Fly   371 MILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPNCRGERPNVMKPKAQFLKELERYNKEK 429
            ||.||||.|||||||||||.|..||||||:||.||||....|.      |.||:..||:
Human   366 MIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMD------KALEKSKKER 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 21/69 (30%)
PHD_ING1_2 360..404 CDD:277059 34/43 (79%)
ING1NP_005528.4 ING <189..254 CDD:289749 21/70 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..349 36/206 (17%)
PHD_ING1_2 355..399 CDD:277059 34/43 (79%)
PBR. /evidence=ECO:0000250|UniProtKB:Q9H160 405..422 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40119
Inparanoid 1 1.050 204 1.000 Inparanoid score I3742
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109185
Panther 1 1.100 - - LDO PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.