DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and Ing5

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_609647.1 Gene:Ing5 / 34752 FlyBaseID:FBgn0032516 Length:285 Species:Drosophila melanogaster


Alignment Length:404 Identity:105/404 - (25%)
Similarity:165/404 - (40%) Gaps:129/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 INSATYVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVD-HYYDLYLSLQNSADAGRRSRS 75
            ::||.|::||:|.:|:||.:::|....:|.:|.:.:..::.:| |..|.   ::...:.|..|..
  Fly     1 MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDF---MRKLGENGAMSED 62

  Fly    76 ISRMHQSLI-----QAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRDRYALLDDGTP 135
            ..|..|..|     :|:|..|:|:|:.....|::|.::|:||.|                     
  Fly    63 ERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDND--------------------- 106

  Fly   136 SKLQRLQSPMREQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGNGGGSTPNSE 200
              |.|.:..::|:.:..             .||               |..:.:..|...|.:| 
  Fly   107 --LARFEGEIQEKASST-------------RAK---------------SEEVVAKKGRKKTKDS- 140

  Fly   201 RSSHVSNGGNSGSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNSANEASGSGG 265
                                     :.||.|:                    :|.|::|.:|.|.
  Fly   141 -------------------------KTTGKKK--------------------KSASSDEETGRGN 160

  Fly   266 GSGERKSSLGGASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRK 330
            ......||:..:|.||||.|     ...|..:....|..|.|                 :||..:
  Fly   161 NQSNANSSVNSSSNAGQGSK-----KKKSKVNQEKETRKGGA-----------------QKKTVE 203

  Fly   331 VRGSGASNAN-ASTREETPPPETIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLK 394
            |..|...:.: |:|.........:||:|||||:|:|:|:||||.|||..||||||||:||.|..|
  Fly   204 VDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTK 268

  Fly   395 PKGKWFCPNCRGER 408
            ||||||||.|..:|
  Fly   269 PKGKWFCPKCTQDR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 29/104 (28%)
PHD_ING1_2 360..404 CDD:277059 32/43 (74%)
Ing5NP_609647.1 TNG2 1..278 CDD:227367 103/398 (26%)
ING 6..108 CDD:289749 29/127 (23%)
PHD_ING4_5 234..278 CDD:277061 32/43 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439836
Domainoid 1 1.000 64 1.000 Domainoid score I6682
eggNOG 1 0.900 - - E1_COG5034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 1 1.000 - - otm14092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
109.880

Return to query results.
Submit another query.