DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ing4

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001018304.1 Gene:ing4 / 322113 ZFINID:ZDB-GENE-050522-47 Length:250 Species:Danio rerio


Alignment Length:392 Identity:91/392 - (23%)
Similarity:151/392 - (38%) Gaps:150/392 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHYYDLYLSLQNSADAGRRSRSISRMHQ 81
            |:::|:||:||||.::||....:||:|.:...|...:|.....|.:...:..:.::...:.::.|
Zfish     6 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKGQIDSLAREYTANARTLSSEQKLSLLRQIQQ 70

  Fly    82 SLIQAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRDRYALLDDGTPSKLQRLQSPMR 146
            |..:.:|.||:|:|:.....|::|..:|:||||                       |.|.::.::
Zfish    71 SYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTD-----------------------LARFEADLK 112

  Fly   147 EQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGNGGGSTPNSERSSHVSNGGNS 211
            |:..::                                                     ::..::
Zfish   113 EKQIES-----------------------------------------------------TDYDST 124

  Fly   212 GSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNSANEASGSGGGSGERKSSLGG 276
            .|.||.|...|.:.:.....||:.:                  ||.::.|..   ||::|..|  
Zfish   125 SSKGNKSDIRGPKKKEVNRARSKVK------------------NSDDDCSSK---SGQKKVKL-- 166

  Fly   277 ASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANA 341
                                :.|...|:.|...|                           |.:.
Zfish   167 --------------------TQSTEFSTPAVNFG---------------------------NVHP 184

  Fly   342 STREETPPPETIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPNCRG 406
            |...:.|    :||:|||||:|:|:|:||||.|||..|.||||||:||.|..||:|||:||.|..
Zfish   185 SDVLDMP----VDPNEPTYCLCHQVSYGEMIGCDNTDCSIEWFHFACVGLTTKPRGKWYCPRCSQ 245

  Fly   407 ER 408
            ||
Zfish   246 ER 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 30/98 (31%)
PHD_ING1_2 360..404 CDD:277059 29/43 (67%)
ing4NP_001018304.1 ING 6..105 CDD:289749 30/121 (25%)
TNG2 7..246 CDD:227367 88/388 (23%)
PHD_ING4 198..245 CDD:277154 31/46 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.