DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and Ing4

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_006237411.1 Gene:Ing4 / 297597 RGDID:1309407 Length:249 Species:Rattus norvegicus


Alignment Length:396 Identity:91/396 - (22%)
Similarity:145/396 - (36%) Gaps:159/396 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHYYDLYLSLQNSADAGRRSRSISRMHQ 81
            |:::|:||:||||.::||....:||:|.:...|..::|.....|:|...|..:..:...:.::.:
  Rat     6 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLRQIQE 70

  Fly    82 SLIQAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRDRYALLDDGTPSKLQRLQSPMR 146
            :..:.:|.||:|:|:.....|::|..:|:||||                       |.|.::.::
  Rat    71 AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTD-----------------------LARFEADLK 112

  Fly   147 EQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGNGGGSTPNSERSSHVSNGGNS 211
            |:..::                                                     |:..:|
  Rat   113 EKQIES-----------------------------------------------------SDYDSS 124

  Fly   212 GSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNSANEASGSGGGSGERKSSLGG 276
            .|.|...|       ||..::...|..|         .|.|....|.:|:               
  Rat   125 SSKGKRKG-------RTQKEKKAARARS---------KGKNSDEEAPKAA--------------- 158

  Fly   277 ASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANA 341
                                                            :||.:.||.|......:
  Rat   159 ------------------------------------------------QKKLKLVRTSPEYGMPS 175

  Fly   342 STREETPPPET----IDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCP 402
            .|.....|.:.    :||:|||||:|:|:|:||||.|||..|.||||||:||.|..||:||||||
  Rat   176 VTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCP 240

  Fly   403 NCRGER 408
            .|..||
  Rat   241 RCSQER 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 30/98 (31%)
PHD_ING1_2 360..404 CDD:277059 30/43 (70%)
Ing4XP_006237411.1 TNG2 7..245 CDD:227367 88/392 (22%)
ING_ING4 11..104 CDD:341095 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335679
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.