DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and phf-34

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_509661.1 Gene:phf-34 / 184793 WormBaseID:WBGene00009025 Length:246 Species:Caenorhabditis elegans


Alignment Length:111 Identity:30/111 - (27%)
Similarity:39/111 - (35%) Gaps:37/111 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 KKRKVRGSG----ASNANASTREE-----TPPP--ETIDPDEPTYCV-----------------C 363
            ||.||..:|    .....|.|.:|     .|.|  |..|.|...|.:                 |
 Worm   141 KKTKVGKNGKIAKVDKKTAKTVKEKQVLDLPQPKIEINDEDIDQYILEQAAPKKKNVTRWICPTC 205

  Fly   364 NQIS-FGEMILCDNDLCPIEWFHFSCVSLVLKPK---GKWFCPNCR 405
            ::.| ||.   |....|. :|:|.:||.. .|.|   .||.|..|:
 Worm   206 DKSSKFGS---CGCVGCG-DWYHITCVGF-KKAKEVPDKWACKYCK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749
PHD_ING1_2 360..404 CDD:277059 16/64 (25%)
phf-34NP_509661.1 PHD 201..245 CDD:214584 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.