DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and lsy-13

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001367153.1 Gene:lsy-13 / 178470 WormBaseID:WBGene00020287 Length:247 Species:Caenorhabditis elegans


Alignment Length:95 Identity:30/95 - (31%)
Similarity:45/95 - (47%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 SGKKKKRKVRGSGASNANAST------REETPPPE-TIDPDEP--TYCVCNQISFGEMILCDNDL 378
            |.:..::|....|..:|.:|.      |::.|..| .:...||  .||.|.......||.|:|..
 Worm   131 SVRSHRKKKLSEGDDDAPSSVDEKKRGRKKKPESEKAVAAAEPPKMYCWCQLDKNDTMIECENPG 195

  Fly   379 CPIEWFHFSCVSLVLKPKGKWFCPN-CRGE 407
            |...||||:|:.::..|.|.|:|.| ||.:
 Worm   196 CKYGWFHFTCIGMITAPAGDWYCTNECRAQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749
PHD_ING1_2 360..404 CDD:277059 18/44 (41%)
lsy-13NP_001367153.1 PHD_SF 177..222 CDD:419867 18/44 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2440
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2364
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.