DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and ing4

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_012823088.2 Gene:ing4 / 100491241 XenbaseID:XB-GENE-1013994 Length:288 Species:Xenopus tropicalis


Alignment Length:392 Identity:99/392 - (25%)
Similarity:160/392 - (40%) Gaps:137/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHYYDLYLSLQNSADAGRRSRSISRMHQ 81
            |:::|:||:||||.::||....:||:|.:...|...:|.....|:|...|.::..:.:.:.::.:
 Frog    31 YLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKCHIDRLSCQYMSNARSMNSEEKLQLLRQVQE 95

  Fly    82 SLIQAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRDRYALLDDGTPSKLQRLQSPMR 146
            :..:.:|.||:|:|:.....|::|..:|:||||                       |.|.::.::
 Frog    96 AYGKCKEYGDDKVQLAMQTYEMVDKHIRRLDTD-----------------------LARFEADLK 137

  Fly   147 EQGNQAGTGNGGLNGNGLLSAKDLYALGGYAGGVVPGSNAMTSGNGGGSTPNSERSSHVSNGGNS 211
            |:.                               :..|:..:..:.|...|       |.|..|:
 Frog   138 EKH-------------------------------IESSDYDSCSSKGKKIP-------VLNWDNT 164

  Fly   212 GSNGNASGGGGGELQRTGSKRSRRRNESVVNNGSSLEMGGNESNSANEASGSGGGSGERKSSLGG 276
            .....|.|.|..| ::....||:.:                  ||.:||:    .:.::|..|  
 Frog   165 LIILPAEGRGQKE-KKAAKVRSKVK------------------NSDDEAA----KNTQKKIKL-- 204

  Fly   277 ASGAGQGRKASLQSASGSLASGSAATSSGAAGGGGASGAGVVGGNNSGKKKKRKVRGSGASNANA 341
                       :|:|           ..||..|            |.||             .:.
 Frog   205 -----------VQTA-----------EYGAPAG------------NFGK-------------VHP 222

  Fly   342 STREETPPPETIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPNCRG 406
            |...:.|    :||:|||||:|:|:|:||||.|||..|.||||||:||.|..||:||||||.|..
 Frog   223 SDVLDMP----VDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLATKPRGKWFCPRCSQ 283

  Fly   407 ER 408
            ||
 Frog   284 ER 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749 30/98 (31%)
PHD_ING1_2 360..404 CDD:277059 30/43 (70%)
ing4XP_012823088.2 TNG2 32..284 CDD:227367 96/388 (25%)
ING_ING4 36..129 CDD:341095 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434088at2759
OrthoFinder 1 1.000 - - FOG0000296
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X195
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.