DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7379 and Taf3

DIOPT Version :9

Sequence 1:NP_650656.1 Gene:CG7379 / 42140 FlyBaseID:FBgn0038546 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001258271.1 Gene:Taf3 / 100360100 RGDID:2324594 Length:930 Species:Rattus norvegicus


Alignment Length:112 Identity:30/112 - (26%)
Similarity:48/112 - (42%) Gaps:36/112 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 SGASNANASTREETPPPETIDPDEPTYCV-------------CNQISFGE-MILCDNDLCPIEWF 384
            |.|.:|.|..|...  .||:.    ||.:             ||:...|. ||.||:  |. :|:
  Rat   835 SAAGSAKAPVRSVV--TETVS----TYVIRDEWGNQIWICPGCNKPDDGSPMIGCDD--CD-DWY 890

  Fly   385 HFSCVSLVLKP--KGKWFCPNCRGERPNVMKPKAQFLKELERYNKEK 429
            |:.||.::..|  :.:||||.|           |..:|:.:::.:.|
  Rat   891 HWPCVGIMAAPPEEMQWFCPKC-----------ANKIKKDKKHKRRK 926

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7379NP_650656.1 ING 17..116 CDD:289749
PHD_ING1_2 360..404 CDD:277059 18/59 (31%)
Taf3NP_001258271.1 BTP 5..79 CDD:128846
RSB_motif 596..>654 CDD:292910
PHD_TAF3 867..912 CDD:276997 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.