DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi1 and pasi2

DIOPT Version :10

Sequence 1:NP_650655.1 Gene:pasi1 / 42139 FlyBaseID:FBgn0038545 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_649883.1 Gene:pasi2 / 41113 FlyBaseID:FBgn0037680 Length:258 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:60/147 - (40%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YTAALSAVMITLISYMLAGGESAQLYSPLFETDIRSSMPVAGGFFIIYFLLIILSSYLVYYGIKI 91
            |..|::|...|...|.:...|    :..:....:|:.:.|...|.:|..|:..::|.|:...::.
  Fly    86 YCYAMAAPGSTHYGYYIISYE----FVYVGNKHVRNMLIVFALFSLIMALINFVTSVLLCVALRK 146

  Fly    92 STRGWLLPWLGLIGLAILFQFSWSLWLIGGYYIYLEQTFSALLNFVWVAYN-------------- 142
            .....::|||            || :.|...:..|...|.|::|.::.|||              
  Fly   147 EYERKVMPWL------------WS-FAIFTVWRALALIFFAIVNDLYFAYNVIMVLLWTIFCVLS 198

  Fly   143 IYCWLVVFSQYQIFLEI 159
            ||.|.||   |.:|||:
  Fly   199 IYGWAVV---YSLFLEL 212

Return to query results.
Submit another query.