DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pasi1 and C18D11.1

DIOPT Version :9

Sequence 1:NP_001247158.1 Gene:pasi1 / 42139 FlyBaseID:FBgn0038545 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_001370046.1 Gene:C18D11.1 / 176611 WormBaseID:WBGene00007679 Length:263 Species:Caenorhabditis elegans


Alignment Length:200 Identity:34/200 - (17%)
Similarity:70/200 - (35%) Gaps:88/200 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GYTAALSAVMI-TLISYMLAGG------------------ESAQLYSP----------------- 54
            |.:.|.||:.| |||.|:|..|                  .|.:|.:.                 
 Worm    15 GLSVATSAIAIYTLILYLLLSGLAAWGLSDTTQNGDASHYNSCELEAQGKINAENRKLTFTGGRT 79

  Fly    55 ---------------LFETDIR---SSMPVAGGFFIIYFLLIILSSYLVYYGIKISTRGWLLPWL 101
                           |:..:::   |:..|:....|:.::.::|:|.::..|:....:..||||.
 Worm    80 VVVVQDSTSYHCSLGLYTEELKYSASNRYVSLVIDILLYVSLVLASIVLLIGLCSYNQWLLLPWA 144

  Fly   102 ---------GLIGLAILFQFSW--------SLWLIGGYYIYLEQTFSALLNFVWVAYNIYCWLVV 149
                     |.|.:..:|.:|:        .::.:|             |.|:    :|..|:::
 Worm   145 FLMIIDIVRGFISVFFIFWYSYGNLARIATGIFFLG-------------LQFL----HISLWMII 192

  Fly   150 FSQYQ 154
            .:::|
 Worm   193 AAKFQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pasi1NP_001247158.1 DUF4728 76..156 CDD:292485 16/95 (17%)
C18D11.1NP_001370046.1 alpha-crystallin-Hsps_p23-like <64..>113 CDD:412199 3/48 (6%)
DUF4728 122..199 CDD:374176 16/92 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR36694
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.