| Sequence 1: | NP_001287381.1 | Gene: | TyrR / 42136 | FlyBaseID: | FBgn0038542 | Length: | 631 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014559.1 | Gene: | DopEcR / 38539 | FlyBaseID: | FBgn0035538 | Length: | 322 | Species: | Drosophila melanogaster |
| Alignment Length: | 221 | Identity: | 65/221 - (29%) |
|---|---|---|---|
| Similarity: | 103/221 - (46%) | Gaps: | 25/221 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 118 ILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSW 182
Fly 183 QLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALA 247
Fly 248 ITCPPMLGWYEPGRRDLRE-CRYNQNEGYVIFSAMGSFFIPMAVMIYVYARISCVIASRHDNMTD 311
Fly 312 ISVHNKKF--------KRYTAADVEN 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TyrR | NP_001287381.1 | 7tm_4 | 127..>249 | CDD:304433 | 42/121 (35%) |
| 7tm_1 | 133..>298 | CDD:278431 | 49/165 (30%) | ||
| DopEcR | NP_001014559.1 | 7tm_classA_rhodopsin-like | 18..289 | CDD:410626 | 65/221 (29%) |
| TM helix 1 | 18..42 | CDD:410626 | 7/24 (29%) | ||
| TM helix 2 | 51..73 | CDD:410626 | 11/21 (52%) | ||
| TM helix 3 | 89..111 | CDD:410626 | 5/21 (24%) | ||
| TM helix 4 | 134..150 | CDD:410626 | 4/16 (25%) | ||
| TM helix 5 | 174..197 | CDD:410626 | 5/27 (19%) | ||
| TM helix 6 | 230..252 | CDD:410626 | |||
| TM helix 7 | 264..289 | CDD:410626 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45460667 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24248 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.940 | |||||