DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrR and HTR4

DIOPT Version :9

Sequence 1:NP_001287381.1 Gene:TyrR / 42136 FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001035263.1 Gene:HTR4 / 3360 HGNCID:5299 Length:428 Species:Homo sapiens


Alignment Length:538 Identity:134/538 - (24%)
Similarity:195/538 - (36%) Gaps:223/538 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SWQGIILIAVFATFIVVTVIGNTLVILAILTTRRLRTI-TNCFVMSLAVADLLVGIFVMPPAVAV 176
            |.:.::|:...:|.|::.::||.||::|:...|:||.| ||.|::|||.|||||.:.|||.. |:
Human    16 SVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFG-AI 79

  Fly   177 HLIGS-WQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAV-TRPLTYSRKRRSKRLALIMIL 239
            .|:.. |..|.|.|.:..||||||.||||..||.||:|||.|: .:||.|..|....|:|| |:.
Human    80 ELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIAL-MLG 143

  Fly   240 IVWLLALAIT-CPPMLGWYEPGRRDLRECR-YNQNEG-----------YVIFSAMGSFFIPMAVM 291
            ..|::...|: .|.|.||...|..||.|.| :|||..           |.|..::.:|:||..:|
Human   144 GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLM 208

  Fly   292 IYVYARISCVIASRHDNMTDISVHNKKFKRYTAADVENELSEQEQHSSVGQRQRQATSRTFSNQT 356
            :..|.||                       |..|         ::|:...|..::|         
Human   209 VLAYYRI-----------------------YVTA---------KEHAHQIQMLQRA--------- 232

  Fly   357 IAKELQDMMLSDSDNCAAMGAGGAGGGGGGASSATGGTHCQSLLALPSGGVGGSMGCAKNGCYEL 421
                                         ||||.                               
Human   233 -----------------------------GASSE------------------------------- 237

  Fly   422 TRPSSLKRASTASTTITTMTSGMGPGSSLLDAQWQSQPPGQTGQVQTHSLSQPPRTHSFRHSHGE 486
            :||.|..:.||                                                      
Human   238 SRPQSADQHST------------------------------------------------------ 248

  Fly   487 RDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKSLSNRITSLKKENKTTQTLSIVVGGFIA 551
               .|:|:                                        |.|..:||.|::|.|..
Human   249 ---HRMRT----------------------------------------ETKAAKTLCIIMGCFCL 270

  Fly   552 CWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAFWRLTC------ 610
            ||.|||:..::.||: ::.....:..|..|||:.||.:|||:|||.:..||.||..:.|      
Human   271 CWAPFFVTNIVDPFI-DYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERY 334

  Fly   611 KRFFSAGQKPQFPTNTMS 628
            :|....||.....|.|::
Human   335 RRPSILGQTVPCSTTTIN 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 57/124 (46%)
7tm_1 133..>298 CDD:278431 76/180 (42%)
HTR4NP_001035263.1 7tm_1 36..312 CDD:278431 117/476 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.