DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrR and DRD3

DIOPT Version :9

Sequence 1:NP_001287381.1 Gene:TyrR / 42136 FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_000787.2 Gene:DRD3 / 1814 HGNCID:3024 Length:400 Species:Homo sapiens


Alignment Length:521 Identity:156/521 - (29%)
Similarity:223/521 - (42%) Gaps:145/521 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NESAAAAEWAHFYDLVLSWQGIILIAVFATFIVVTVIGNTLVILAILTTRRLRTITNCFVMSLAV 160
            |.:.|:....|.| ..||:..:||..||         ||.||.:|:|..|.|:|.||..|:||||
Human    19 NSTGASQARPHAY-YALSYCALILAIVF---------GNGLVCMAVLKERALQTTTNYLVVSLAV 73

  Fly   161 ADLLVGIFVMPPAVAVHLIGS-WQLGWVLCDIWISLDVLLCTASILSLCAISVDRYLAVTRPLTY 224
            |||||...|||..|.:.:.|. |....:.||::::|||::||||||:|||||:|||.||..|:.|
Human    74 ADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHY 138

  Fly   225 SR---KRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQNEGYVIFSAMGSFFI 286
            ..   :...:|:|| ||..||:||.|::||.:.|:...|  |...|..: |..:||:|::.||::
Human   139 QHGTGQSSCRRVAL-MITAVWVLAFAVSCPLLFGFNTTG--DPTVCSIS-NPDFVIYSSVVSFYL 199

  Fly   287 PMAVMIYVYARISCVIASRHDNMTDISVHNKKFKRYTAADVENELSEQEQHSSVGQRQRQATSRT 351
            |..|.:.|||||..|:..|            :.||.        |:.|..       |..:....
Human   200 PFGVTVLVYARIYVVLKQR------------RRKRI--------LTRQNS-------QCNSVRPG 237

  Fly   352 FSNQTIAKELQDMMLSDSDN-CAAMGAGGAGGGGGGASSATGGTHCQSLLALPSGGVGGSMGCAK 415
            |..||::.:...:.|....: |.....||.|      ....||                      
Human   238 FPQQTLSPDPAHLELKRYYSICQDTALGGPG------FQERGG---------------------- 274

  Fly   416 NGCYELTRPSSLKRASTASTTITTMTSGMGPGSSLLDAQWQSQPPGQTGQVQTHSLSQPPRTHSF 480
                ||.|..  |..::.|.||....|                       ::...||        
Human   275 ----ELKREE--KTRNSLSPTIAPKLS-----------------------LEVRKLS-------- 302

  Fly   481 RHSHGERDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKSLSNRITSLKKENKTTQTLSIV 545
                                            :|..|.:.....|..|...| :|.|.||.::||
Human   303 --------------------------------NGRLSTSLKLGPLQPRGVPL-REKKATQMVAIV 334

  Fly   546 VGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFYSVDFRAAFWR-LT 609
            :|.||.||||||:.:::.........|..|..|.||||:.|||:||.||..::::||.||.: |:
Human   335 LGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILS 399

  Fly   610 C 610
            |
Human   400 C 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 60/125 (48%)
7tm_1 133..>298 CDD:278431 77/168 (46%)
DRD3NP_000787.2 7tm_4 44..>216 CDD:304433 82/184 (45%)
7tm_1 46..383 CDD:278431 138/465 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D189663at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.