DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrR and ADRA1A

DIOPT Version :9

Sequence 1:NP_001287381.1 Gene:TyrR / 42136 FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_150646.3 Gene:ADRA1A / 148 HGNCID:277 Length:475 Species:Homo sapiens


Alignment Length:541 Identity:140/541 - (25%)
Similarity:208/541 - (38%) Gaps:205/541 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NGTDAVALTEPGPTAPVTTFNYYNESAAAAEWAHFYDLVLSWQGIILIAVFATFIVVTVIGNTLV 137
            |.:|:...|:  |.|||      |.|.|                |:|..:....|:..|:||.||
Human     7 NASDSSNCTQ--PPAPV------NISKA----------------ILLGVILGGLILFGVLGNILV 47

  Fly   138 ILAILTTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTA 202
            ||::...|.|.::|:.::::|||||||:...|:|.:....::|.|..|.|.|:||.::|||.|||
Human    48 ILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTA 112

  Fly   203 SILSLCAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLREC 267
            ||:.||.||:|||:.|:.||.|......:| .|:.:|.||.|:|.|:..|:.||.:|...|...|
Human   113 SIMGLCIISIDRYIGVSYPLRYPTIVTQRR-GLMALLCVWALSLVISIGPLFGWRQPAPEDETIC 176

  Fly   268 RYNQNEGYVIFSAMGSFFIPMAVMIYVYARISCVIASRHDNMTDISVHNKKFKRYTAADVENELS 332
            :.|:..|||:|||:|||::|:|:::.:|.|: .|:|.|.             .|...:.::.:.|
Human   177 QINEEPGYVLFSALGSFYLPLAIILVMYCRV-YVVAKRE-------------SRGLKSGLKTDKS 227

  Fly   333 EQEQHSSVGQRQRQATSRTFSNQTIAKELQDMMLSDSDNCAAMGAGGAGGGGGGASSATGGTHCQ 397
            :.|          |.|.|....                        .|..||.|.:||...||  
Human   228 DSE----------QVTLRIHRK------------------------NAPAGGSGMASAKTKTH-- 256

  Fly   398 SLLALPSGGVGGSMGCAKNGCYELTRPSSLKRASTASTTITTMTSGMGPGSSLLDAQWQSQPPGQ 462
                                                                             
Human   257 ----------------------------------------------------------------- 256

  Fly   463 TGQVQTHSLSQPPRTHSFRHSHGERDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKSLSN 527
                                                                          .|.
Human   257 --------------------------------------------------------------FSV 259

  Fly   528 RITSLKKENKTTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPF 592
            |:....:|.|..:||.||||.|:.||||||:...|..|..:.:.|:.:.|.:.|||:.||.|||.
Human   260 RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPI 324

  Fly   593 IYAFYSVDFRAAF---WRLTC 610
            ||...|.:|:.||   .|:.|
Human   325 IYPCSSQEFKKAFQNVLRIQC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 53/121 (44%)
7tm_1 133..>298 CDD:278431 71/164 (43%)
ADRA1ANP_150646.3 7tm_4 37..341 CDD:304433 126/481 (26%)
7tm_1 43..326 CDD:278431 118/460 (26%)
Nuclear localization signal 334..349 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.