DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TyrR and ADRA1D

DIOPT Version :9

Sequence 1:NP_001287381.1 Gene:TyrR / 42136 FlyBaseID:FBgn0038542 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_000669.1 Gene:ADRA1D / 146 HGNCID:280 Length:572 Species:Homo sapiens


Alignment Length:603 Identity:170/603 - (28%)
Similarity:241/603 - (39%) Gaps:208/603 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AASSSSLRGLGLGS--------GVGVGGLPENISIVYEDAGNGTGGGGVGGVGGGYPSGPNGTDA 77
            :::..|..|.|.||        |..|||:|          |...|||||.|.|.|   ..|.:.|
Human    18 SSAGGSSAGGGGGSAGGAAPSEGPAVGGVP----------GGAGGGGGVVGAGSG---EDNRSSA 69

  Fly    78 VALTEPGPTAPVTTFNYYNESAAAAEWAHFYDLVLSWQGIILIAVFATFIVVTVIGNTLVILAIL 142
               .|||...   .....|.:||..      .||:|.||:.:....|.||::.|.||.||||::.
Human    70 ---GEPGSAG---AGGDVNGTAAVG------GLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVA 122

  Fly   143 TTRRLRTITNCFVMSLAVADLLVGIFVMPPAVAVHLIGSWQLGWVLCDIWISLDVLLCTASILSL 207
            ..|.|:|:||.|:::|||||||:...|:|.:..:.::|.|..|...||:|.::|||.||||||||
Human   123 CNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCCTASILSL 187

  Fly   208 CAISVDRYLAVTRPLTYSRKRRSKRLALIMILIVWLLALAITCPPMLGWYEPGRRDLRECRYNQN 272
            |.||||||:.|...|.|......::.|.|:.|: |::||.::..|:|||.||...|.|.|...:.
Human   188 CTISVDRYVGVRHSLKYPAIMTERKAAAILALL-WVVALVVSVGPLLGWKEPVPPDERFCGITEE 251

  Fly   273 EGYVIFSAMGSFFIPMAVMIYVYARISCVIASRHDNMTDISVHNKKFKRYTAADVENELSEQEQH 337
            .||.:||::.||::||||::.:|.|:..|                  .|.|...:|..:      
Human   252 AGYAVFSSVCSFYLPMAVIVVMYCRVYVV------------------ARSTTRSLEAGV------ 292

  Fly   338 SSVGQRQRQATSRTFSNQTIAKELQDMMLSDSDNCAAMGAGGAGGGGGGASSATGGTHCQSLLAL 402
                :|:|...|             :::|......||.||.||.|                    
Human   293 ----KRERGKAS-------------EVVLRIHCRGAATGADGAHG-------------------- 320

  Fly   403 PSGGVGGSMGCAKNGCYELTRPSSLKRASTASTTITTMTSGMGPGSSLLDAQWQSQPPGQTGQVQ 467
                                                 |.|..|                      
Human   321 -------------------------------------MRSAKG---------------------- 326

  Fly   468 THSLSQPPRTHSFRHSHGERDRERLRSHHHHPHYHHQAGVTTTSTSGNTSANTNSKSLSNRITSL 532
                      |:||                                         .|||.|:...
Human   327 ----------HTFR-----------------------------------------SSLSVRLLKF 340

  Fly   533 KKENKTTQTLSIVVGGFIACWLPFFINYLITPFLAEHQASQMLAKALTWLGWFNSAINPFIYAFY 597
            .:|.|..:||:||||.|:.||.|||....:.....:.:.|:.:.|.:.|||:|||.:||.||...
Human   341 SREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCS 405

  Fly   598 SVDFRAAFWRL---TCKR 612
            |.:|:.||.||   .|:|
Human   406 SREFKRAFLRLLRCQCRR 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TyrRNP_001287381.1 7tm_4 127..>249 CDD:304433 56/121 (46%)
7tm_1 133..>298 CDD:278431 74/164 (45%)
ADRA1DNP_000669.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77 24/77 (31%)
7tmA_alpha1D_AR 97..413 CDD:320450 132/487 (27%)
TM helix 1 98..124 CDD:320450 10/25 (40%)
TM helix 2 131..157 CDD:320450 12/25 (48%)
TM helix 3 169..199 CDD:320450 21/29 (72%)
TM helix 4 211..234 CDD:320450 7/23 (30%)
TM helix 5 251..280 CDD:320450 12/28 (43%)
TM helix 6 341..371 CDD:320450 14/29 (48%)
TM helix 7 381..406 CDD:320450 11/24 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.