DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14321 and AT5G17610

DIOPT Version :9

Sequence 1:NP_650650.1 Gene:CG14321 / 42134 FlyBaseID:FBgn0038540 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_568353.1 Gene:AT5G17610 / 831627 AraportID:AT5G17610 Length:121 Species:Arabidopsis thaliana


Alignment Length:79 Identity:27/79 - (34%)
Similarity:40/79 - (50%) Gaps:12/79 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SKNEITYHELEVTCDQHAQCIGLSPVG----------VAKINCIRQCISPSCYQDIYAFNELEEG 104
            ||:.....::|:. .:.::|.|....|          :||.||..:|:||.|||.||..:.||||
plant    28 SKSPRPISDVEIR-QKKSECYGDIESGLWGWQCKSSAIAKENCALRCLSPVCYQLIYESDPLEEG 91

  Fly   105 EID-ARLNSFKGCV 117
            |.| .|...:|.|:
plant    92 EKDLIRSQEYKYCM 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14321NP_650650.1 DUF4787 53..116 CDD:292648 24/73 (33%)
AT5G17610NP_568353.1 DUF4787 36..104 CDD:406437 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111076
Panther 1 1.100 - - LDO PTHR35455
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.