DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and ATG8G

DIOPT Version :10

Sequence 1:NP_650649.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_191623.1 Gene:ATG8G / 825235 AraportID:AT3G60640 Length:121 Species:Arabidopsis thaliana


Alignment Length:115 Identity:64/115 - (55%)
Similarity:87/115 - (75%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRK 68
            |..:::||.|:||:.|..:||.||.|||||||||:.|:....:||||||||||||||||.::|||
plant     3 NVSFRQDHDFEKRKAEALRIREKYSDRVPVIVEKSEKSDIPNIDKKKYLVPADLTVGQFVYVIRK 67

  Fly    69 RINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            ||.|..:.|:|.||:||:|||.|.|..:|.|:.::|.|||::|:.||.:|
plant    68 RIQLSAEKAIFIFVDNVLPPTGAMMSTIYDENKEEDGFLYVTYSGENTFG 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_650649.1 Ubl_ATG8_GABARAP_like 7..113 CDD:340544 60/105 (57%)
ATG8GNP_191623.1 Ubl_ATG8 12..114 CDD:340545 58/101 (57%)

Return to query results.
Submit another query.