DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and ATG8H

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_566283.1 Gene:ATG8H / 819816 AraportID:AT3G06420 Length:119 Species:Arabidopsis thaliana


Alignment Length:112 Identity:49/112 - (43%)
Similarity:71/112 - (63%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRIN 71
            :|...|.|:|..|.:.|..|||||:|||:||.......:::|.|||||.|:|||.|..::.||:.
plant     8 FKDQFSSDERLKESNNIIAKYPDRIPVIIEKYSNADLPDMEKNKYLVPRDMTVGHFIHMLSKRMQ 72

  Fly    72 LRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            |.|..|||.||:|.:|.|::.|.:||....::|.|||:.|:.|..:|
plant    73 LDPSKALFVFVHNTLPQTASRMDSLYNTFKEEDGFLYMCYSTEKTFG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 48/110 (44%)
ATG8HNP_566283.1 Atg8 16..119 CDD:281049 45/102 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.