DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and Gabarapl1

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001037759.1 Gene:Gabarapl1 / 689161 RGDID:1596143 Length:117 Species:Rattus norvegicus


Alignment Length:117 Identity:86/117 - (73%)
Similarity:107/117 - (91%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67
            |.:|||:||.|:.|:.||:|||:|||||||||||||||.|..:|||:|||||:||||||||||||
  Rat     1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR 65

  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYGR 119
            |||:|||:|||||||||.|||||||||.||:::.::|||||::|:||:|||:
  Rat    66 KRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 82/110 (75%)
Gabarapl1NP_001037759.1 Ubl_ATG8_GABARAP_like 5..111 CDD:340544 79/105 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.