DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and MAP1LC3B2

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001078950.1 Gene:MAP1LC3B2 / 643246 HGNCID:34390 Length:125 Species:Homo sapiens


Alignment Length:114 Identity:33/114 - (28%)
Similarity:64/114 - (56%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEK-APKTRYAELDKKKYLVPADLTVGQFYFLIRKRI 70
            :|:..:|::|..:...||.::|.::|||:|: ..:.:...|||.|:|||..:.:.:...:||:|:
Human     7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL 71

  Fly    71 NLRPDDALFFFVN-NVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            .|..:.|.|..|| :.:...|..:..:|:...|:|.|||:....:..:|
Human    72 QLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 32/112 (29%)
MAP1LC3B2NP_001078950.1 GABARAP 7..120 CDD:176355 32/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.