DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and gabarapl1

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001025652.1 Gene:gabarapl1 / 595040 XenbaseID:XB-GENE-946688 Length:117 Species:Xenopus tropicalis


Alignment Length:117 Identity:86/117 - (73%)
Similarity:107/117 - (91%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67
            |.:|||:||.|:.|:.||:|||:|||||||||||||||.|..:|||:|||||:||||||||||||
 Frog     1 MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIR 65

  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYGR 119
            |||:|||:|||||||||.|||||||||.||:::.::|||||::|:||:|||:
 Frog    66 KRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 82/110 (75%)
gabarapl1NP_001025652.1 Interaction with beta-tubulin. /evidence=ECO:0000250 1..22 11/20 (55%)
Ubl_ATG8_GABARAP_like 5..111 CDD:340544 79/105 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X355
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.