DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and Gabarap

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_742033.1 Gene:Gabarap / 58974 RGDID:61911 Length:117 Species:Rattus norvegicus


Alignment Length:116 Identity:90/116 - (77%)
Similarity:107/116 - (92%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67
            |.:.||::|.|:|||:||:|||:|||||||||||||||.|..:|||||||||:||||||||||||
  Rat     1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65

  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            |||:||.:|||||||||||||||||||.|||||.::|:||||:|:||:|||
  Rat    66 KRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 87/110 (79%)
GabarapNP_742033.1 Interaction with beta-tubulin 1..22 11/20 (55%)
Ubl_ATG8_GABARAP 2..116 CDD:340752 87/113 (77%)
Interaction with GPHN. /evidence=ECO:0000269|PubMed:10900017 36..117 65/81 (80%)
Interaction with GABRG2. /evidence=ECO:0000250|UniProtKB:O95166 36..68 26/31 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343688
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.