powered by:
Protein Alignment Atg8b and flot2
DIOPT Version :9
Sequence 1: | NP_001303480.1 |
Gene: | Atg8b / 42132 |
FlyBaseID: | FBgn0038539 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011034.1 |
Gene: | flot2 / 496443 |
XenbaseID: | XB-GENE-5910825 |
Length: | 428 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 21/63 - (33%) |
Gaps: | 20/63 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 LTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYGR 119
|||.|.| :..|.....|..|..|....|| ...:|:|.::||.:
Frog 118 LTVEQIY---------QDRDQFAKLVREVAAPDVGRMG-----------IEILSFTIKDVYDK 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1654 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.