DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and flot2

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001011034.1 Gene:flot2 / 496443 XenbaseID:XB-GENE-5910825 Length:428 Species:Xenopus tropicalis


Alignment Length:63 Identity:15/63 - (23%)
Similarity:21/63 - (33%) Gaps:20/63 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYGR 119
            |||.|.|         :..|.....|..|..|....||           ...:|:|.::||.:
 Frog   118 LTVEQIY---------QDRDQFAKLVREVAAPDVGRMG-----------IEILSFTIKDVYDK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 14/60 (23%)
flot2NP_001011034.1 Flot 6..417 CDD:330594 15/63 (24%)
SPFH_flotillin 34..178 CDD:259798 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.