DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and map1lc3b

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_989346.1 Gene:map1lc3b / 394972 XenbaseID:XB-GENE-953620 Length:124 Species:Xenopus tropicalis


Alignment Length:114 Identity:34/114 - (29%)
Similarity:64/114 - (56%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEK-APKTRYAELDKKKYLVPADLTVGQFYFLIRKRI 70
            :|:..|.::|..:...||.::|.::|||:|: ..:.:...|||.|:|||..:.:.:...:||:|:
 Frog     7 FKQRRSLEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL 71

  Fly    71 NLRPDDALFFFVN-NVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            .|..:.|.|..|| :.:...|..:..:|:...|:|.|||:.|..:..:|
 Frog    72 QLNSNQAFFLLVNGHSMVSVSTPISEVYEREKDEDGFLYMVYASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 33/112 (29%)
map1lc3bNP_989346.1 GABARAP 7..120 CDD:176355 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.