powered by:
Protein Alignment Atg8b and Atg12
DIOPT Version :9
Sequence 1: | NP_001303480.1 |
Gene: | Atg8b / 42132 |
FlyBaseID: | FBgn0038539 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648551.3 |
Gene: | Atg12 / 39383 |
FlyBaseID: | FBgn0036255 |
Length: | 111 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 28/71 - (39%) |
Gaps: | 13/71 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 VPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPT-SATMG 94
||:| .|:.:.|..:.|||.....|.|.:.|...:.:|.:||....|. ...:.
Fly 36 VPII------------KKRTWTVDPNKTVGWIQTFIHKFLKLDASEQIFLYVNQTFAPAPDQIIK 88
Fly 95 ALYQEH 100
.||:.|
Fly 89 NLYECH 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.