DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and Map1lc3a

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_955794.1 Gene:Map1lc3a / 362245 RGDID:735183 Length:121 Species:Rattus norvegicus


Alignment Length:120 Identity:38/120 - (31%)
Similarity:67/120 - (55%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEK-APKTRYAELDKKKYLVPADLTVGQFYF 64
            |..:..:|:..||..|..|..:||.::|.::|||:|: ..:.:...|||.|:|||..:.:.:...
  Rat     1 MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVK 65

  Fly    65 LIRKRINLRPDDALFFFVN-NVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            :||:|:.|.|..|.|..|| :.:...|..:..:|::..|:|.|||:.|..:..:|
  Rat    66 IIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 36/112 (32%)
Map1lc3aNP_955794.1 Ubl_ATG8_MAP1LC3A 4..120 CDD:340754 36/115 (31%)
Important for interaction with ATG13 and for autophagosome formation. /evidence=ECO:0000250|UniProtKB:Q9H492 49..53 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.