DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and atg8

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_596531.1 Gene:atg8 / 2541386 PomBaseID:SPBP8B7.24c Length:121 Species:Schizosaccharomyces pombe


Alignment Length:116 Identity:65/116 - (56%)
Similarity:88/116 - (75%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67
            |..|:|.|.||:||:.|..:||.|||||:|||.||..|:..|.:||||||||:|||||||.::||
pombe     1 MRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQFVYVIR 65

  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            |||.|.|:.|:|.|::.::|||:|.|..:|:||..:|.||||:|:.||.:|
pombe    66 KRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 62/110 (56%)
atg8NP_596531.1 GABARAP 5..116 CDD:176355 62/110 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1215
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1291
OMA 1 1.010 - - QHG54038
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 1 1.000 - - otm47100
orthoMCL 1 0.900 - - OOG6_100707
Panther 1 1.100 - - O PTHR10969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X355
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.