DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and lgg-2

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001255523.2 Gene:lgg-2 / 177989 WormBaseID:WBGene00002981 Length:142 Species:Caenorhabditis elegans


Alignment Length:114 Identity:39/114 - (34%)
Similarity:66/114 - (57%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAEL-DKKKYLVPADLTVGQFYFLIRKRI 70
            :|:...|.:|:.:.::||.:.|::||||:|:....|...| |:.|:|||..:||.:...::|:|:
 Worm    29 FKERRPFHERQKDVEEIRSQQPNKVPVIIERFDGERSLPLMDRCKFLVPEHITVAELMSIVRRRL 93

  Fly    71 NLRPDDALFFFVN-NVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            .|.|..|.|..|| ..:...|.:|..||.:..|.|.|:|:.||.:..:|
 Worm    94 QLHPQQAFFLLVNERSMVSNSMSMSNLYSQERDPDGFVYMVYTSQPAFG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 38/112 (34%)
lgg-2NP_001255523.2 GABARAP 29..142 CDD:176355 38/112 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.