DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and lgg-3

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_498228.1 Gene:lgg-3 / 175793 WormBaseID:WBGene00002982 Length:118 Species:Caenorhabditis elegans


Alignment Length:97 Identity:26/97 - (26%)
Similarity:44/97 - (45%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DRVPV---IVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPP-- 88
            |:|.|   .:..||..:    :||..:.|.| ||..|...:||.:|::.:::||.:::|...|  
 Worm    27 DKVTVRLRNIADAPVLK----NKKMVVNPTD-TVASFILKLRKLLNIQANNSLFLYIDNTFAPSP 86

  Fly    89 --TSATMGALYQEHFDKDYFLYISYTDENVYG 118
              |..|:...|.........|.:.|:....||
 Worm    87 DTTFETLSRCYSVKITDKEILELQYSITPAYG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 24/95 (25%)
lgg-3NP_498228.1 Ubiquitin_like_fold 28..118 CDD:391949 23/94 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.