DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and AgaP_AGAP007296

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_308525.2 Gene:AgaP_AGAP007296 / 1269871 VectorBaseID:AGAP007296 Length:125 Species:Anopheles gambiae


Alignment Length:100 Identity:18/100 - (18%)
Similarity:41/100 - (41%) Gaps:8/100 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KIRRKYPDRVPVIVE---KAPKTRYAELDKKKYLVPADLTVGQFYFLIRKRINLRPDDALFFFVN 83
            |:.::...::.:::.   .||     .|.:||:.|..:..:......|.|.:.|..::.||.::|
Mosquito    31 KVEKQESKKIDIVLHATGSAP-----ILKQKKWAVDQEKPISAIVKFIHKYLKLDAEERLFLYIN 90

  Fly    84 NVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            ....|:...:.....|.:..:..|.:.|.....:|
Mosquito    91 QTFAPSPDQIIKNLYECYGTNGKLILHYAKTQAWG 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 17/98 (17%)
AgaP_AGAP007296XP_308525.2 APG12_C 39..125 CDD:176356 16/90 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.