DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg8b and LOC120098596

DIOPT Version :9

Sequence 1:NP_001303480.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_038954120.1 Gene:LOC120098596 / 120098596 RGDID:41293225 Length:117 Species:Rattus norvegicus


Alignment Length:116 Identity:48/116 - (41%)
Similarity:76/116 - (65%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67
            |.:.:|:|||.:.|..|..|||.|.||||||||||...::..:.|::|:|:|:..||.||.::::
  Rat     1 MKWMFKEDHSLEHRFVESAKIRVKPPDRVPVIVEKVSGSQIVDTDRRKHLIPSHSTVAQFMWILK 65

  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118
            |||....:.|.|..|:..:|.:..|:|.||::..|:|.|||:::..||.:|
  Rat    66 KRIQFPSEKATFLCVDKTVPQSRLTVGQLYKKEKDEDGFLYVAHRGENTFG 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg8bNP_001303480.1 GABARAP 7..118 CDD:176355 46/110 (42%)
LOC120098596XP_038954120.1 Ubiquitin_like_fold 5..116 CDD:421700 46/110 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000590
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100707
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X355
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.