DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxt and Pxn

DIOPT Version :9

Sequence 1:NP_650648.3 Gene:Pxt / 42131 FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster


Alignment Length:627 Identity:218/627 - (34%)
Similarity:321/627 - (51%) Gaps:90/627 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PVCGNI--RSVYRSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGI-----WTP-RAHSSDGT 284
            |.|.::  .|.|||:||||||  .|...|||:.....|:.||.||:|.     ||. ..:|....
  Fly   766 PNCTDMCFHSRYRSIDGTCNN--LQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAK 828

  Fly   285 PLLGARKISRTLLSDVD-RPHPKYNLMVMQFGQVLAHDISQT-SSIRLEDGSLVQCCSPEGKVAL 347
            |  .||.:|.:|::..: .|..:...||||:||.|.||:... .|:..|....:.|   :....:
  Fly   829 P--SARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHAIPSVSSESWDGIDC---KKSCEM 888

  Fly   348 SPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDC----------QLSYGKQLTKVTH 402
            :|     .|.||.|.|:|.  .....||::.||.|.:    |          .:.:.:|:.::|.
  Fly   889 AP-----PCYPIEVPPNDP--RVRNRRCIDVVRSSAI----CGSGMTSLFFDSVQHREQINQLTS 942

  Fly   403 FVDASPVYGSSDEASRSLR--AFRGGRLRMMNDFGR--DLLPLT--NDKKACPS--EEAGKSCFH 459
            ::|||.|||.|...::.||  ..:.|.||:...|.|  |:||..  .|...|..  :|...|||.
  Fly   943 YIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFV 1007

  Fly   460 SGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPI 524
            |||.|.|:.:.|:.:..:..|||||:|..|.::|.....:||:||||:||.|:|||||:.::||:
  Fly  1008 SGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPL 1072

  Fly   525 IIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSV-------DGKFQ-IRQEH 581
            |||...|:   ::..:||    ||..:||:|.|||:.||.|.||:.:       :..|| |.|.|
  Fly  1073 IIGESGME---MMGEYQG----YNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGH 1130

  Fly   582 GRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQP--MQQVDSSISQGLSRFLFRGDNPFGLDL 644
                  :.:....|.|.|:......|.::|...:.|  ::..|.:::..|:..||:..:...|||
  Fly  1131 ------LLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDL 1189

  Fly   645 AAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQF-----PIEIAQKLSRVYRTPDDIDLWVGGLL 704
            ||||||||||.|:..||.|.:|........||..     ..||.||:..:|..||::|:|:||:|
  Fly  1190 AAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGIL 1254

  Fly   705 EKAVEGGVVGVTFAEIIADQFARFKQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLC---D 766
            |..||||.||..|..::.:||.|.:.|||.|||     |||.|:|.||.:|::....|:||   |
  Fly  1255 EDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYE-----NPGVFSPEQLTQIKQANFGRVLCDVGD 1314

  Fly   767 NSDRLTLQAVPLAAFVRADHPGNQMIGCDDPNLPSVNLEAWR 808
            |.|::|..     .|:.|.|.|... .|:|  :..:||..|:
  Fly  1315 NFDQVTEN-----VFILAKHQGGYK-KCED--IIGINLYLWQ 1348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337
An_peroxidase 237..772 CDD:281139 205/578 (35%)
peroxinectin_like 396..767 CDD:188655 149/396 (38%)
PxnNP_523891.2 LRR_RI 51..>161 CDD:238064
leucine-rich repeat 54..77 CDD:275380
LRR_8 55..112 CDD:290566
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
LRR_8 124..184 CDD:290566
leucine-rich repeat 126..149 CDD:275380
LRR_4 148..185 CDD:289563
leucine-rich repeat 150..173 CDD:275380
Ig 240..325 CDD:299845
IG_like 242..325 CDD:214653
I-set 366..450 CDD:254352
Ig 384..451 CDD:143165
I-set 458..546 CDD:254352
Ig 472..536 CDD:299845
I-set 553..644 CDD:254352
Ig 570..643 CDD:299845
An_peroxidase 777..1317 CDD:281139 204/575 (35%)
peroxidasin_like 898..1338 CDD:188658 166/469 (35%)
VWC 1465..1523 CDD:278520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I2172
eggNOG 1 0.900 - - E1_KOG2408
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276568at2759
OrthoFinder 1 1.000 - - FOG0000202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11475
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.