DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxt and Igsf9b

DIOPT Version :9

Sequence 1:NP_650648.3 Gene:Pxt / 42131 FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:250 Identity:56/250 - (22%)
Similarity:85/250 - (34%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PAPLATSTESSKKPEKATSGLLKKCLPCSDGIRCVPQIQCPAHVRMESHEKPQICDLPAGKFGYC 104
            |||.||..:........:.|.|:.   .|.|:. :|.:..|.......|..|       ..||  
  Rat  1118 PAPPATKWQERPMQPLVSQGQLRH---TSQGMG-IPVLPYPEPAEPGGHGGP-------STFG-- 1169

  Fly   105 CETGQNHTAPKPETSPKERRSGFPTILSPAVLDEARRNFEHLMHGVAQIPV--RRGFPDFA---- 163
            .:|......|:|..||::.|...|: |...||..:|      :..:.|.|:  |.|.|:.|    
  Rat  1170 LDTRWYEPQPRPRPSPRQARRAEPS-LHQVVLQPSR------LSPLTQSPLSSRTGSPELAARAR 1227

  Fly   164 --HGLVFHSTAKDDLHNFAISNSA---IEQVMTTQLFGKKEQVPVEDFITNNVPIKFTETPLAHH 223
              .||:    .:.::....:...|   ..:..|....|...|.......:....:.||.....:.
  Rat  1228 PRPGLL----QQAEMSEITLQPPAAVSFSRKSTPSSTGSPSQSSRSGSPSYRPTMGFTTLATGYP 1288

  Fly   224 CQP----PPVCGNIRSVY------RSMDGTCNNPEPQRSLWGAAGQPMERMLPPA 268
            ..|    ||..|:...|:      |.|......|||..:|      |...:||||
  Rat  1289 SPPPGPAPPAPGDNLDVFGQTPSPRRMGEEPLRPEPPTTL------PTSGILPPA 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337 11/51 (22%)
An_peroxidase 237..772 CDD:281139 10/37 (27%)
peroxinectin_like 396..767 CDD:188655
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021 34/151 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332 52/243 (21%)
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462
Ig 229..321 CDD:386229
Ig <353..414 CDD:386229
Ig 438..502 CDD:319273
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.