DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxt and Ptgs2

DIOPT Version :9

Sequence 1:NP_650648.3 Gene:Pxt / 42131 FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_058928.3 Gene:Ptgs2 / 29527 RGDID:620349 Length:604 Species:Rattus norvegicus


Alignment Length:610 Identity:126/610 - (20%)
Similarity:212/610 - (34%) Gaps:165/610 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 ITNNVP------IKFTETPLAHHCQPPPVCGNIRSVYRSMDGTCNNPEPQRSLWGAAGQPMERML 265
            |.||:|      :::..|..:|....||.. |:...|:|.:...|     .|.:       .|.|
  Rat    87 IVNNIPFLRNSIMRYVLTSRSHLIDSPPTY-NVHYGYKSWEAFSN-----LSYY-------TRAL 138

  Fly   266 PPAYEDGIWTPRAHSSDGTPLLGARK--ISRTLLSDVDRPHPK-YNLMVMQFGQVLAHDISQTSS 327
            ||..:|   .|......|...|...|  :.:.||.....|.|: .|:|...|.|...|       
  Rat   139 PPVADD---CPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGTNMMFAFFAQHFTH------- 193

  Fly   328 IRLEDGSLVQCCSPEGKVALSPQQSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLS 392
                                                  :||.....|...|.|            
  Rat   194 --------------------------------------QFFKTDQKRGPGFTR------------ 208

  Fly   393 YGKQLTKVTHFVDASPVYGSSDEASRSLRAFRGGRLRMMNDFGRDLLPLTNDKKA---CPSEEAG 454
                  .:.|.||.:.|||.:.:....||.|:.|:|:.....|....|...|.:.   .|.....
  Rat   209 ------GLGHGVDLNHVYGETLDRQHKLRLFQDGKLKYQVIGGEVYPPTVKDTQVDMIYPPHVPE 267

  Fly   455 KSCFHSGDGRTNQIISLITLQILLAREHNRVAGALHELNPSASDETLFQEARRIVIAE------- 512
            ...|..|......:..|:....:..||||||...|.:.:|...||.|||.:|.|:|.|       
  Rat   268 HLRFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTSRLILIGETIKIVIE 332

  Fly   513 --MQHIT-YN---EFLPIIIGPQQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSV 571
              :||:: |:   :|.|.::..||.:          |.:        .|.:||:           
  Rat   333 DYVQHLSGYHFKLKFDPELLFNQQFQ----------YQN--------RIASEFN----------- 368

  Fly   572 DGKFQIRQEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQGLSRFLFRG 636
                .:...|..:.:..||.|..:.    .|:..|::.:  |....:.....|.::.::..:..|
  Rat   369 ----TLYHWHPLLPDTFNIEDQEYT----FKQFLYNNSI--LLEHGLAHFVESFTRQIAGRVAGG 423

  Fly   637 DN-PFGLD-LAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQF--PIEIAQKLSRVYRTPDDID 697
            .| |..:. :|..:|.:.|:...:|.|:|.:........|||:.  ..|:|.:|..:|...|.::
  Rat   424 RNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYHDIDAME 488

  Fly   698 LWVGGLLEKAVEGGVVGVTFAEIIADQFARFKQGD-----RYYYEYDNGINPGAF-NPLQLQEIR 756
            |:...|:||.....:.|.|..|:.|....:...|:     :|:       .|..| ..:..:.|.
  Rat   489 LYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYW-------KPSTFGGEVGFRIIN 546

  Fly   757 KVTLARLLCDNSDRLTLQAVPLAAF 781
            ..::..|:|:|     ::..|.|:|
  Rat   547 TASIQSLICNN-----VKGCPFASF 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337
An_peroxidase 237..772 CDD:281139 114/563 (20%)
peroxinectin_like 396..767 CDD:188655 86/396 (22%)
Ptgs2NP_058928.3 EGF 21..53 CDD:278437
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 123/604 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.