DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxt and Igsf9b

DIOPT Version :9

Sequence 1:NP_650648.3 Gene:Pxt / 42131 FlyBaseID:FBgn0261987 Length:809 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:390 Identity:80/390 - (20%)
Similarity:124/390 - (31%) Gaps:100/390 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PAPLATSTESSKKPEKATSGLLKKCLPCSDGIRCVPQIQCPAHVRMESHEKPQICDLPAGKFGYC 104
            |||.||..:........:.|.|:.   .|.|:. :|.:..|.......|..|       ..||  
Mouse  1120 PAPPATKWQERPMQPLVSQGQLRH---TSQGMG-IPVLPYPEPAEPGGHGGP-------STFG-- 1171

  Fly   105 CETGQNHTAPKPETSPKERRSGFPTILSPAVLDEARRNFEHLMHGVAQIPV--RRGFPDFA---- 163
            .:|......|:|..||::.|...|: |...||..:|      :..:.|.|:  |.|.|:.|    
Mouse  1172 LDTRWYEPQPRPRPSPRQARRAEPS-LHQVVLQPSR------LSPLTQSPLSSRTGSPELAARAR 1229

  Fly   164 --HGLVFHSTAKDDLHNFAISNSA---IEQVMTTQLFGKKEQVPVEDFITNNVPIKFTETPLAHH 223
              .||:    .:.::....:...|   ..:..|....|...|.......:....:.||.....:.
Mouse  1230 PRPGLL----QQAEMSEITLQPPAAVSFSRKSTPSSTGSPSQSSRSGSPSYRPTMGFTTLATGYP 1290

  Fly   224 CQP----PPVCGNIRSVY------RSMDGTCNNPEPQRSLWGAAGQPMERMLPPAYEDGIWTPRA 278
            ..|    ||..|:...|:      |.|......|||..:|      |...:||||..:.....|.
Mouse  1291 SPPPGPAPPAPGDTLDVFGQTPSPRRMGEEPLRPEPPTTL------PTSGILPPAPGNAAVPERL 1349

  Fly   279 HSSDGTPLLGARKISRTLLSDVDRPHPKYNLMVMQFGQVLAHDISQTSSIRLEDGSLVQCCSPEG 343
            .:      |..::|.:          ||.:            ....:.|.:..|||..|......
Mouse  1350 EA------LRYQRIKK----------PKKS------------SKGSSKSKKRSDGSASQAQQLPS 1386

  Fly   344 KVALSPQQSHFACM---PIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKVTHFVD 405
            ...|.|.::  .|:   ..|..||.            |.|||.:    |.....:..|.:.:.||
Mouse  1387 SQVLWPDEA--VCLRKKKRHSRPDP------------FARLSDL----CHRQLPEDQTAILNSVD 1433

  Fly   406  405
            Mouse  1434  1433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxtNP_650648.3 GH64-TLP-SF <67..119 CDD:295337 11/51 (22%)
An_peroxidase 237..772 CDD:281139 35/178 (20%)
peroxinectin_like 396..767 CDD:188655 3/10 (30%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273
I-set 141..227 CDD:369462
Ig 231..323 CDD:386229
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021 34/151 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.