DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and AT1G76110

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_177738.1 Gene:AT1G76110 / 843943 AraportID:AT1G76110 Length:338 Species:Arabidopsis thaliana


Alignment Length:268 Identity:64/268 - (23%)
Similarity:97/268 - (36%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   977 PFRSTITTTKKSDSLCK-------LYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDL 1034
            |.::|:.....|.:..|       |:|:........| |.||.|.....|.. ..|.|..:.|||
plant     9 PSQATVEMMATSPAKIKEYPEPLALHEVVVKDSSVFW-DTLRRFHSIMSTKF-MIPVIGGKELDL 71

  Fly  1035 YRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGA-SSSAAYTLRKHYTKNLLTFE-CHF--DRGD- 1094
            :.||:.|..|||:.:|...|.|:::.|:....| ::||::.|||||...|..:| .|.  .||. 
plant    72 HVLYVEVTRRGGYEKVVVEKKWREVGGVFRFSATTTSASFVLRKHYLNLLFHYEQVHLFTARGPL 136

  Fly  1095 IDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAID--- 1156
            :.|:.......:.||:......:.|                |....::.|...||:...||.   
plant   137 LHPIATFHANPSTSKEMALVEYTPP----------------SIRYHNTHPPSQGSSSFTAIGTIE 185

  Fly  1157 -----GY--------------------PGYPGGSPYPVASGPQPDYATA-------GQMQRPPSQ 1189
                 ||                    || |..||..|.:.....|...       |:.:|...:
plant   186 GKFDCGYLVKVKLGSEILNGVLYHSAQPG-PSSSPTAVLNNAVVPYVETGRRRRRLGKRRRSRRR 249

  Fly  1190 NNPQTPHP 1197
            .:|..|.|
plant   250 EDPNYPKP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 32/94 (34%)
DUF3518 2191..2451 CDD:288854
AT1G76110NP_177738.1 BRIGHT 39..128 CDD:128777 31/90 (34%)
HMGB-UBF_HMG-box 255..318 CDD:238686 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.