DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and AT1G55650

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_175961.1 Gene:AT1G55650 / 842014 AraportID:AT1G55650 Length:337 Species:Arabidopsis thaliana


Alignment Length:235 Identity:55/235 - (23%)
Similarity:92/235 - (39%) Gaps:51/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   977 PFRSTITTTKKSDSLCKLY-EMDDNPDRRGWLDKLRAFME--ERRTPITACPTISKQPLDLYRLY 1038
            |..::......|..:..|| ::..||:.  :.:.||.|.|  :::..|   |.:..:.|||:||:
plant    12 PANASALDNDVSSHMSMLYQDIVRNPEL--FWEMLRDFHESSDKKFKI---PIVGGKSLDLHRLF 71

  Fly  1039 IYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFE--CHFDRGDIDPLPI 1100
            ..|..|||..:|.|.:..|::........: :::|:.|||.|.|.|..||  .:|..    ||..
plant    72 NEVTSRGGLEKVIKDRRCKEVIDAFNFKTTITNSAFVLRKSYLKMLFEFEHLYYFQA----PLST 132

  Fly  1101 IQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDG--YPGY-- 1161
            ..:.|...|....|:|                    :..:||....||:.....|||  ..||  
plant   133 FWEKEKALKLLIEKSA--------------------NRDKDSQELKPGTVITGIIDGKFESGYLI 177

  Fly  1162 --------PGGSPYPVA----SGPQPDYATAGQMQRPPSQ 1189
                    ..|..|.::    .|.:...::.|...:||.:
plant   178 STKVGSEKLKGMLYHISPETKRGKKKAKSSQGDSHKPPKR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 29/95 (31%)
DUF3518 2191..2451 CDD:288854
AT1G55650NP_175961.1 BRIGHT 35..126 CDD:128777 29/95 (31%)
HMGB-UBF_HMG-box 215..278 CDD:238686 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.