DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and AT3G13350

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_566454.1 Gene:AT3G13350 / 820535 AraportID:AT3G13350 Length:319 Species:Arabidopsis thaliana


Alignment Length:261 Identity:63/261 - (24%)
Similarity:93/261 - (35%) Gaps:91/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 PYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTK 986
            ||||:|:.|.:..|         ...:..|.||.|                             .
plant     8 PYSQTHVEPVNGYP---------SDNKRCDDSSVP-----------------------------A 34

  Fly   987 KSDSLCK---LYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFV 1048
            |.|.|.:   |:          | :|||||:......:.. ||:....|||:||:|.|..|||..
plant    35 KYDDLVRNSALF----------W-EKLRAFLGLTSKTLKV-PTVGGNTLDLHRLFIEVTSRGGIE 87

  Fly  1049 EVTKSKTWKDIAGLLGIGAS-SSAAYTLRKHYTKNLLTFE--CHFDRGDIDPLPIIQQVEAGSKK 1110
            .|.|.:.||::.|......: :||::.|||:|.|.|...|  .:.::    |:..:|..:. :.|
plant    88 RVVKDRKWKEVIGAFSFPTTITSASFVLRKYYLKFLFQLEHVYYLEK----PVSSLQSTDE-ALK 147

  Fly  1111 KTAKAASVPSPG--------------GGHLDAG--TTNSTGS--------------SNSQDSFPA 1145
            ..|..:..|..|              .|..|:|  .|...||              |.||.:...
plant   148 SLANESPNPEEGIDEPQVGYEVQGFIDGKFDSGYLVTMKLGSQELKGVLYHIPQTPSQSQQTMET 212

  Fly  1146 P 1146
            |
plant   213 P 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 32/93 (34%)
DUF3518 2191..2451 CDD:288854
AT3G13350NP_566454.1 ARID_HMGB9-like 42..127 CDD:350636 32/96 (33%)
HMGB-UBF_HMG-box 238..301 CDD:238686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3936
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.