DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and rsc9

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_596197.1 Gene:rsc9 / 2539948 PomBaseID:SPBC1703.02 Length:780 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:66/262 - (25%)
Similarity:103/262 - (39%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   975 QEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYI 1039
            :||..|..:.|.::||...|.|               :|.:||..||...|.|.::|:.||.||.
pombe    10 EEPVYSNKSLTNENDSFLSLIE---------------SFSQERGVPIDINPKIGRKPILLYELYK 59

  Fly  1040 YVKERGGFVEVTKSKT-WKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECH-------------- 1089
            .|.:|||:..|:.::. |.:||........:.:|..|:..|.|.|:::|.|              
pombe    60 KVIKRGGYDAVSATEDGWTNIAEEFNQSDPARSAGILQNVYFKYLISWEIHDHWHLLLPPPSTLE 124

  Fly  1090 --------FDRGDI----------DPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGS 1136
                    .:|..:          :|:.||...:..|.||..|:........| ::.....:..|
pombe   125 LSENRQNVLERVKVFNSCSPPKPTNPITIIDNDKTHSFKKFYKSLVKEDEENG-IEKKINEAMNS 188

  Fly  1137 SNSQDSFPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAA 1201
            |.||   |.|  ::.|.|...:|..| ..|.||.||          :|:...:|:..|| |...|
pombe   189 SASQ---PLP--NSTNFASTTFPSVP-FHPLPVDSG----------LQKYIDRNSNLTP-PALGA 236

  Fly  1202 AV 1203
            .|
pombe   237 GV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 27/113 (24%)
DUF3518 2191..2451 CDD:288854
rsc9NP_596197.1 BRIGHT 21..113 CDD:128777 31/106 (29%)
ARM <388..451 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.