DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and Arid4a

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:XP_036013289.1 Gene:Arid4a / 238247 MGIID:2444354 Length:1283 Species:Mus musculus


Alignment Length:305 Identity:65/305 - (21%)
Similarity:115/305 - (37%) Gaps:52/305 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   805 MPMGPPHHMGPP--HGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQD---NGIS 864
            :|:..|.|.|.|  ...||.|..:|.|..       :.:.:..|...|......::.:   ..:|
Mouse   123 LPLTNPEHFGTPVIAKKTNRGRRSSLPIT-------EDEKEEESSEEEDEDKRRLNDELLGKVVS 180

  Fly   865 SSGPTGAAGMHAVTSVVTTGPDGTSM--DEVSQQSTLSNASAASG-------------EDPQCTT 914
            .:....:.|.:....|..:..|..::  |:...:|.:.:...:..             |...|..
Mouse   181 VASTAESTGWYPALVVSPSCNDDVTVKKDQCLVRSFIDSKFYSIARKDIKELDILTLPESELCAR 245

  Fly   915 PKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFR 979
            |..|:...:.:..:.|.:...         ...|..:.||..:...||            :|...
Mouse   246 PGLRRASVFLKGRIVPDNWKM---------DISEILESSSSDDEECPA------------EEHEE 289

  Fly   980 STITTTKKSDSLCKLYEMDDNPDRR-GWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKE 1043
            ......||.:.  :|.|.:.:|:.| .:|.:|..|||:|.|||...|.:..:.|:|::|:..|..
Mouse   290 EKEKEAKKEEE--ELPEEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYH 352

  Fly  1044 RGGFVEVTKSKTWKDIAGLLGIG-ASSSAAYTLRKHYTKNLLTFE 1087
            :||...:.....||.|...|||. .:|:|:|.::..|.|.|..||
Mouse   353 QGGCGNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 32/89 (36%)
DUF3518 2191..2451 CDD:288854
Arid4aXP_036013289.1 Tudor_ARID4A_rpt1 4..61 CDD:410530
Tudor_SF 62..118 CDD:413384
RBB1NT 170..262 CDD:400474 10/91 (11%)
ARID_ARID4A 312..397 CDD:350646 29/84 (35%)
CBD_RBP1_like 580..638 CDD:350843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.