DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osa and cfi-1

DIOPT Version :9

Sequence 1:NP_001163639.1 Gene:osa / 42130 FlyBaseID:FBgn0261885 Length:2716 Species:Drosophila melanogaster
Sequence 2:NP_492644.2 Gene:cfi-1 / 188793 WormBaseID:WBGene00000476 Length:467 Species:Caenorhabditis elegans


Alignment Length:340 Identity:83/340 - (24%)
Similarity:125/340 - (36%) Gaps:112/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 TNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQD-NGISSSGPTGAAGMHAVTSVVTT 883
            :|:..|.:.||..|.||                ||..|.|. .|:       |:|:.|::     
 Worm    83 SNLRAPLNLPPIFQALQ----------------GPFSIQQQLLGL-------ASGLTAIS----- 119

  Fly   884 GPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGE 948
                ..:|:..:::|      ..||....|....||........                  |.|
 Worm   120 ----PGLDDYDEENT------NQGEPEDLTLGGFRKETSVKSEE------------------PSE 156

  Fly   949 EYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAF 1013
            ....:|.|.|..              :|.|:             :|||:.|:..|:.|||....|
 Worm   157 SGINASGPAWSY--------------EEQFK-------------QLYELSDDVKRKEWLDDWLNF 194

  Fly  1014 MEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGAS-SSAAYTLRK 1077
            |.....|:|..|.::||.||||.||..|.:.||.||:...|.|::|...|.:.:| :|||:|||.
 Worm   195 MHRIGKPVTRIPIMAKQVLDLYELYRLVVQHGGLVEIINKKLWREITKGLNLPSSITSAAFTLRT 259

  Fly  1078 HYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDS 1142
            .|.|.|..:||  ::..:.....:||...|::::.....:.|                      |
 Worm   260 QYQKYLYDYEC--EKEKLSNQSDLQQAIDGNRREAPGRRTAP----------------------S 300

  Fly  1143 FPAP---PGSAPNAA 1154
            ||.|   |.:|..||
 Worm   301 FPLPFQLPHAASAAA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osaNP_001163639.1 BRIGHT 1001..1092 CDD:128777 38/91 (42%)
DUF3518 2191..2451 CDD:288854
cfi-1NP_492644.2 ARID 183..269 CDD:198082 36/85 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.900

Return to query results.
Submit another query.